Analytical Data
-
Gene name
MRPL54
- Application
-
Alternative Names
MRPL54;Large ribosomal subunit Protein mL54
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P161
-
Expression Region
15-138aa
-
AA Sequence
GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL
-
Molecular Weight
18.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPL54, or mitochondrial ribosomal protein L54, plays a critical role in mitochondrial protein synthesis and is essential for proper mitochondrial function. As a component of the mitochondrial ribosome, MRPL54 is involved in the translation of mitochondrial mRNA, which encodes proteins vital for oxidative phosphorylation and cellular energy production. Dysfunction of MRPL54 has been linked to various mitochondrial disorders, contributing to a deeper understanding of the molecular mechanisms underlying mitochondrial diseases. Research on MRPL54 recombinant proteins has gained significant attention as it provides insights into the structure-function relationships of mitochondrial ribosomal proteins and their interactions within the ribosomal machinery. Additionally, the study of MRPL54 facilitates the exploration of potential therapeutic targets for diseases associated with mitochondrial dysfunction. By producing and characterizing MRPL54 recombinantly, researchers aim to elucidate its role in mitochondrial translation and its implications for broader metabolic processes. Overall, the investigation of MRPL54 recombinant proteins is pivotal in advancing our knowledge of mitochondrial biology and addressing the challenges posed by mitochondrial-related pathologies.











