Analytical Data
-
Gene name
MRPL42
- Application
-
Alternative Names
MRPL42；MRPL31；MRPS32；RPML31；Large ribosomal subunit Protein mL42
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6G3
-
Expression Region
33-142aa
-
AA Sequence
KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
-
Molecular Weight
40.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPL42 (Mitochondrial Ribosomal Protein L42) is a crucial component of the mitochondrial ribosome, playing a significant role in mitochondrial protein synthesis and cellular energy metabolism. Research on MRPL42 has garnered interest due to its association with various mitochondrial diseases and its potential implications in metabolic disorders. Mitochondria are essential organelles responsible for ATP production, and abnormalities in mitochondrial function can lead to severe health issues, including neurodegenerative diseases and myopathies. Recent studies have highlighted the importance of MRPL42 in maintaining mitochondrial integrity and regulating the translation of mitochondrial genes. Understanding the structure and function of MRPL42 is vital for unraveling the complex mechanisms underlying mitochondrial biogenesis and function. Furthermore, as mitochondrial dysfunction is increasingly linked to aging and chronic diseases, MRPL42 is of great interest for potential therapeutic interventions. Researchers are employing techniques such as recombinant protein expression and functional assays to elucidate MRPL42's interactions and its role in mitochondrial dynamics. This research not only aims to clarify the molecular basis of MRPL42's function in mitochondrial biology but also seeks to explore its implications for developing strategies to combat mitochondrial-related diseases. Thus, the study of MRPL42 serves as a promising avenue for understanding mitochondrial pathology and could pave the way for novel therapeutic approaches.
