Cat: PA1000-4942

Recombinant Human SULT1A1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SULT1A1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SULT1A1;STP;STP1;Sulfotransferase 1A1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P50225

  • Expression Region

    1-295aa

  • AA Sequence

    MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPD DLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGI PSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSY YHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVL YLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTN YTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSL SFRSEL

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SULT1A1 (Sulfotransferase 1A1) is an important enzyme in the family of sulfotransferases, playing a crucial role in the metabolism of various endogenous and exogenous compounds. This enzyme catalyzes the sulfonation process, which is essential for the detoxification of drugs, hormones, and environmental pollutants by converting them into more water-soluble forms that can be easily eliminated from the body. Variations in the SULT1A1 gene can lead to significant differences in enzyme activity, influencing individual responses to medications and susceptibility to diseases. For instance, polymorphisms in SULT1A1 have been associated with altered drug metabolism, affecting the efficacy and toxicity of therapeutic agents. Furthermore, research has indicated a link between SULT1A1 activity and the risk of certain cancers, making it a focal point in pharmacogenetics and cancer research. The development of recombinant SULT1A1 proteins provides valuable tools for studying the enzyme's mechanisms, substrate specificity, and potential interactions with new drugs. These studies can pave the way for personalized medicine approaches, allowing for tailored therapies based on an individual's genetic makeup. Overall, research on SULT1A1 recombinant proteins is crucial for elucidating the role of sulfotransferases in metabolism and for advancing our understanding of drug interactions, efficacy, and safety.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US