Analytical Data
-
Gene name
SULT1A1
- Application
-
Alternative Names
SULT1A1;STP;STP1;Sulfotransferase 1A1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50225
-
Expression Region
1-295aa
-
AA Sequence
MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPD DLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGI PSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSY YHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVL YLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTN YTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSL SFRSEL
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SULT1A1 (Sulfotransferase 1A1) is an important enzyme in the family of sulfotransferases, playing a crucial role in the metabolism of various endogenous and exogenous compounds. This enzyme catalyzes the sulfonation process, which is essential for the detoxification of drugs, hormones, and environmental pollutants by converting them into more water-soluble forms that can be easily eliminated from the body. Variations in the SULT1A1 gene can lead to significant differences in enzyme activity, influencing individual responses to medications and susceptibility to diseases. For instance, polymorphisms in SULT1A1 have been associated with altered drug metabolism, affecting the efficacy and toxicity of therapeutic agents. Furthermore, research has indicated a link between SULT1A1 activity and the risk of certain cancers, making it a focal point in pharmacogenetics and cancer research. The development of recombinant SULT1A1 proteins provides valuable tools for studying the enzyme's mechanisms, substrate specificity, and potential interactions with new drugs. These studies can pave the way for personalized medicine approaches, allowing for tailored therapies based on an individual's genetic makeup. Overall, research on SULT1A1 recombinant proteins is crucial for elucidating the role of sulfotransferases in metabolism and for advancing our understanding of drug interactions, efficacy, and safety.











