Cat: PA1000-4789

Recombinant Human TRIM5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TRIM5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TRIM5;RNF88;Tripartite motif-containing Protein 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9C035

  • Expression Region

    1-493aa

  • AA Sequence

    MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDK GESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGE KLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLR QKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNEL QNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGV DGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVD VTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILG SQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYW VIGLEEGVKCSAFQDSSFHTPSVPFIVPLSVIICPDRVGVFLDYEACTVS FFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCSPSS

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TRIM5α is a member of the TRIM (tripartite motif-containing) protein family, known for its role in the innate immune response against retroviral infections, particularly HIV-1. The protein possesses a unique tripartite structure that comprises a RING finger domain, a B-box, and a coiled-coil region, enabling it to recognize and bind to the viral capsid. This interaction initiates a series of antiviral responses, including the recruitment of cellular factors that induce degradation of the viral RNA and protein, thereby limiting viral replication. Research on TRIM5α has expanded to explore its polymorphisms and how variations in the protein may confer differential susceptibility to viral infections among different populations. Additionally, findings have suggested that TRIM5α may have broader implications beyond retroviral defense, potentially influencing various cellular processes such as inflammation and tumor suppression. Recent advances in structural biology and mutagenesis have provided valuable insights into the mechanisms underlying its antiviral activity, leading to potential therapeutic applications in combating retroviral diseases. The exploration of TRIM5α and its variants thus comprises a significant area of study within virology and immunology, with hopes of harnessing its properties for novel antiviral strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US