Analytical Data
-
Gene name
CXCL8
- Application
-
Alternative Names
CXCL8;TSG6;Tumor necrosis factor-inducible gene 6 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10145
-
Expression Region
23-99aa
-
AA Sequence
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
-
Molecular Weight
13.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCL8, also known as Interleukin-8 (IL-8), is a prominent chemokine involved in the regulation of immune responses and inflammation. It primarily functions as a potent chemoattractant for neutrophils and plays a critical role in the recruitment of immune cells to sites of infection or injury. Due to its pivotal role in various inflammatory diseases, including rheumatoid arthritis, chronic obstructive pulmonary disease, and certain cancers, the study of CXCL8 has gained significant attention in biomedical research. The recombinant production of CXCL8 protein allows researchers to investigate its biological functions and mechanisms in vitro and in vivo. This facilitates the exploration of its potential as a therapeutic target, as well as the development of novel anti-inflammatory drugs. The ability to analyze CXCL8's interactions with its receptors and other signaling molecules enhances our understanding of its role in pathological conditions. Through the generation of recombinant CXCL8, scientists can also explore its utility as a diagnostic biomarker, further emphasizing its significance in clinical applications.











