Cat: PA2000-2044

Recombinant Human IL8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL8;IL8;Interleukin-8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10145

  • Expression Region

    29-99aa

  • AA Sequence

    AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCL DPKENWVQRVVEKFLKRAENS

  • Molecular Weight

    8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-8 (IL-8), a chemokine belonging to the CXC chemokine family, plays a crucial role in the inflammatory response by mediating the recruitment and activation of neutrophils and other immune cells to sites of inflammation. Originally identified as a product of activated macrophages, IL-8 has been implicated in various pathological conditions, including autoimmune diseases, infections, and cancer. The recombinant form of IL-8 has gained significant attention in research due to its potential therapeutic applications and its utility as a biomarker for disease progression. Understanding the structure-function relationship of IL-8 through recombinant technology allows researchers to explore its biological mechanisms further and design IL-8-based interventions. The production of recombinant IL-8 in suitable expression systems, such as bacteria or mammalian cells, enables the characterization of its signaling pathways and interactions with specific receptors. This research not only enhances our understanding of IL-8's role in health and disease but also opens avenues for developing novel therapeutic strategies targeting IL-8 or its receptors to modulate inflammatory responses in various clinical settings. Overall, the study of recombinant IL-8 is pivotal in elucidating its function in immune regulation and its potential as a therapeutic target.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US