Analytical Data
-
Gene name
IDUA
- Application
-
Alternative Names
IDUA；Alpha-L-iduronidase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35475
-
Expression Region
28-653aa
-
AA Sequence
APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP
-
Molecular Weight
82.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of recombinant IDUA (alpha-L-iduronidase) has become increasingly vital in the context of lysosomal storage disorders, particularly Hunter syndrome and Hurler syndrome. IDUA is an essential enzyme responsible for the catabolism of glycosaminoglycans, specifically heparan sulfate and dermatan sulfate. Mutations in the IDUA gene lead to enzyme deficiencies, resulting in the accumulation of these substrates in lysosomes, causing progressive cellular and organ damage. Traditional treatment options, like enzyme replacement therapy (ERT), face challenges such as high manufacturing costs, immunogenicity, and limited efficacy due to blood-brain barrier penetration. Consequently, recombinant IDUA proteins are being explored to enhance therapeutic outcomes. Advances in biotechnology have enabled the production of recombinant IDUA with improved stability and activity, which may alleviate some limitations of existing therapies. Additionally, the potential for gene therapy approaches integrating IDUA gene delivery seeks to address the root cause of enzyme deficiency. Ongoing research focuses on optimizing production methods, understanding the biochemical properties of the enzyme, and evaluating the therapeutic potential of recombinant IDUA in preclinical and clinical settings, aiming to improve patient outcomes and quality of life in individuals affected by IDUA-related disorders.
