Cat: PA1000-4767

Recombinant Human IL12A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL12A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL12A;NKSF1;Interleukin-12 subunit alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P29459

  • Expression Region

    23-219aa

  • AA Sequence

    RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHE DITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMAL CLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNF NSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL12A, the alpha subunit of interleukin-12 (IL-12), plays a crucial role in the immune response by modulating T cell and natural killer (NK) cell functions. Understanding the biological activity of IL12A has significant implications for cancer immunotherapy, autoimmune diseases, and infectious diseases. The IL-12 complex, composed of IL12A and IL12B, has been shown to enhance the production of pro-inflammatory cytokines and promote Th1 cell differentiation, which are vital for effective anti-tumor immunity. Researchers have been focusing on the recombinant production of IL12A to investigate its therapeutic potential. This involves employing various expression systems, such as bacterial, yeast, or mammalian cells, to produce bioactive IL12A for both basic research and clinical applications. Analyzing the structural and functional properties of recombinant IL12A can provide insights into its mechanism of action and interactions with other components of the immune system. Moreover, the ability to produce high-purity recombinant IL12A helps in developing novel biotherapeutics that can enhance immune responses in individuals with cancer or chronic infections. Challenges in this research include optimizing production yields, ensuring proper folding and post-translational modifications, and evaluating the stability and efficacy of the protein. As studies progress, the exploration of IL12A’s potential in combination therapies and its role in vaccine development may open new avenues for enhancing immune responses against various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US