Analytical Data
-
Gene name
IDH3B
- Application
-
Alternative Names
IDH3B；Isocitrate dehydrogenase [NAD] subunit beta. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43837
-
Expression Region
35-385aa
-
AA Sequence
ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
-
Molecular Weight
65.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IDH3B, or isocitrate dehydrogenase 3 beta, is a critical enzyme involved in the tricarboxylic acid (TCA) cycle, which plays a fundamental role in cellular metabolism and energy production. Research on IDH3B has gained traction due to its implications in various metabolic disorders and its potential role in cancer metabolism. Mutations in IDH genes, particularly IDH1 and IDH2, are well-documented in numerous cancers, leading to the production of oncometabolites such as 2-hydroxyglutarate; however, IDH3B remains less explored in this context. The focus on IDH3B recombinant protein studies is prompted by the need to understand its enzymatic function, regulation, and interactions within the metabolic pathways. Investigating IDH3B's structural and functional properties can unveil insights into its role in normal physiology and disease states. Given its involvement in energy metabolism, modulation of IDH3B activity may present novel therapeutic targets for metabolic and oncological applications. Thus, the study of IDH3B recombinant protein is vital for elucidating its biological functions and exploring its potential implications in health and disease.
