Analytical Data
-
Gene name
CTCF
- Application
-
Alternative Names
CTCF;Transcriptional repressor CTCF
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49711
-
Expression Region
1-154aa
-
AA Sequence
MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEV VQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQV VNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAES EPMI
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTCF (CCCTC-binding factor) is a highly conserved zinc-finger protein that plays a crucial role in regulating gene expression, chromatin organization, and enhancer-promoter interactions. First identified as a transcriptional repressor, CTCF's functions have expanded to include acting as a chromatin insulator, which helps demarcate active and inactive genomic regions, effectively organizing the three-dimensional architecture of the genome. Its ability to bind to specific DNA sequences allows CTCF to form loops in the chromatin, facilitating communication between enhancers and their target promoters. Research into CTCF has revealed its importance in various biological processes, including development, differentiation, and cellular response to stimuli. Abnormal CTCF function has been implicated in several diseases, including cancer, where disruptions in its regulatory roles may lead to aberrant gene expression. Understanding the mechanisms by which CTCF mediates chromatin structure and gene regulation is pivotal for elucidating its role in health and disease, making it a significant focus of current molecular and genomic research. Investigations into CTCF's complex interactions with other proteins, RNAs, and DNA, as well as its involvement in epigenetic modifications, continue to unveil the multifaceted roles this essential protein plays in maintaining genomic integrity and influencing gene activity.











