Analytical Data
-
Gene name
PPY
- Application
-
Alternative Names
PPY；PNP；Pancreatic polypeptide prohormone
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01298
-
Expression Region
1-95aa
-
AA Sequence
MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYA ADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of PPY (Pancreatic Polypeptide Y), a vital neuropeptide involved in the regulation of appetite and energy homeostasis, has gained significant attention in recent years due to its potential therapeutic applications in obesity and metabolic disorders. PPY is primarily secreted by the pancreatic islets and plays a crucial role in signaling pathways that govern satiety and food intake. Abnormal levels of PPY have been linked to various conditions, including obesity, diabetes, and eating disorders, prompting researchers to explore the molecular mechanisms underlying its production and action. The recombinant production of PPY allows for detailed studies of its structure-function relationship and facilitates the development of pharmacological agents that can modulate its activity. Advances in expression systems, such as bacteria and yeast, have enabled the efficient synthesis and purification of functional PPY, providing valuable tools for investigating its interactions with receptors and other signaling molecules. Moreover, understanding the role of PPY in the central nervous system and its peripheral effects may uncover novel strategies for managing weight and improving metabolic health. As research progresses, the potential for PPY-based therapies continues to expand, making it a focal point in the pursuit of innovative solutions to combat obesity and related metabolic disorders.
