Analytical Data
-
Gene name
HNRNPL
- Application
-
Alternative Names
HNRNPL;HNRPL;Heterogeneous nuclear ribonucleoProtein L
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NTA2
-
Expression Region
89-335aa
-
AA Sequence
IRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGH
-
Molecular Weight
29.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Heterogeneous nuclear ribonucleoprotein L (HNRNPL) is a versatile RNA-binding protein that plays a critical role in various cellular processes, including mRNA processing, splicing, and transport. As a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) family, HNRNPL is primarily localised in the nucleus, where it associates with pre-mRNA and influences alternative splicing decisions, thereby contributing to gene expression regulation. Its involvement in the maturation and export of mRNA makes it essential for cellular responses to environmental changes and developmental signals. Research into the recombination of HNRNPL has garnered attention due to its potential implications in diseases such as cancer and neurodegenerative disorders, where aberrant splicing and RNA metabolism are frequently observed. The study of recombinant HNRNPL proteins enables scientists to explore their structure-function relationships, as well as to identify potential post-translational modifications that may affect their activity and interactions with other cellular molecules. Additionally, understanding HNRNPL's role in the broader context of RNA metabolism could unveil novel therapeutic targets and strategies to modulate splicing regulation in disease contexts. Overall, the investigation of HNRNPL recombinant proteins holds significant promise for advancing our knowledge of RNA biology and its implications in human health and disease.











