Cat: PA1000-4760

Recombinant Human IL2RB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL2RB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL2RB;IL15RB;Interleukin-2 receptor subunit beta

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P14784

  • Expression Region

    27-239aa

  • AA Sequence

    AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCEL LPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKP FENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGH TWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQP LAFRTKPAALGKD

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of IL2RB (Interleukin 2 Receptor Beta) recombinant protein is rooted in the exploration of immune system regulation and its implications for various diseases, including cancer and autoimmune disorders. IL2RB is a critical component of the interleukin-2 receptor complex, which plays a pivotal role in T cell proliferation, survival, and differentiation. Dysregulation of this pathway can lead to impaired immune responses or uncontrolled proliferation of T cells, contributing to disease pathogenesis. Researchers have focused on producing recombinant IL2RB to investigate its structure-function relationship, biochemical properties, and potential therapeutic applications. By utilizing recombinant DNA technology, scientists can express high quantities of IL2RB, enabling detailed studies of its interactions with ligands and other receptors. Furthermore, recombinant IL2RB serves as a valuable tool for developing targeted therapies, particularly in cancer immunotherapy, where modulating T cell responses can enhance therapeutic efficacy. Additionally, understanding the molecular mechanisms underlying IL2RB's role in immune regulation may lead to innovative treatment strategies for immunological diseases. Thus, the research on IL2RB recombinant protein is crucial for advancing our knowledge of immune system dynamics and developing next-generation immunotherapeutics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US