Analytical Data
-
Gene name
IL2RB
- Application
-
Alternative Names
IL2RB；IL15RB；Interleukin-2 receptor subunit beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14784
-
Expression Region
27-239aa
-
AA Sequence
AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCEL LPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKP FENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGH TWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQP LAFRTKPAALGKD
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of IL2RB (Interleukin 2 Receptor Beta) recombinant protein is rooted in the exploration of immune system regulation and its implications for various diseases, including cancer and autoimmune disorders. IL2RB is a critical component of the interleukin-2 receptor complex, which plays a pivotal role in T cell proliferation, survival, and differentiation. Dysregulation of this pathway can lead to impaired immune responses or uncontrolled proliferation of T cells, contributing to disease pathogenesis. Researchers have focused on producing recombinant IL2RB to investigate its structure-function relationship, biochemical properties, and potential therapeutic applications. By utilizing recombinant DNA technology, scientists can express high quantities of IL2RB, enabling detailed studies of its interactions with ligands and other receptors. Furthermore, recombinant IL2RB serves as a valuable tool for developing targeted therapies, particularly in cancer immunotherapy, where modulating T cell responses can enhance therapeutic efficacy. Additionally, understanding the molecular mechanisms underlying IL2RB's role in immune regulation may lead to innovative treatment strategies for immunological diseases. Thus, the research on IL2RB recombinant protein is crucial for advancing our knowledge of immune system dynamics and developing next-generation immunotherapeutics.
