Analytical Data
-
Gene name
HNRNPH1
- Application
-
Alternative Names
HNRNPH1；HNRPH；HNRPH1；Heterogeneous nuclear ribonucleoProtein H
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31943
-
Expression Region
2-216aa
-
AA Sequence
MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAG
-
Molecular Weight
51.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HNRNPH1, known as heterogeneous nuclear ribonucleoprotein H1, is a crucial RNA-binding protein that plays a significant role in post-transcriptional gene regulation, mRNA processing, and stability. It is involved in diverse cellular processes, including splicing, transport, and translation of RNA, making it vital for normal cellular function and development. Dysregulation of HNRNPH1 has been implicated in various diseases, including cancer and neurological disorders, emphasizing the need for in-depth understanding of its molecular mechanisms. The study of recombinant HNRNPH1 protein facilitates the investigation of its structure-function relationships and interaction with RNA and other cellular components. By producing and characterizing HNRNPH1 recombinant protein, researchers can elucidate its role in RNA metabolism and the pathogenesis of related diseases. This research is particularly relevant in the context of developing therapeutic strategies targeting HNRNPH1 and its pathways, with the potential for advancements in precision medicine. The advancements in recombinant protein techniques also open avenues for high-throughput screening of small molecules that may modulate HNRNPH1 function, further enriching our understanding of its biological significance and therapeutic potential.
