Cat: PA1000-4742

Recombinant Human GZMB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GZMB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GZMB;DFNA5;ICERE1;Gasdermin-E

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10144

  • Expression Region

    19-247aa

  • AA Sequence

    GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGS SINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKA KRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQ EDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVS YGRNNGMPPRACTKVSSFVHWIKKTMKRY

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Granzyme B (GZMB) is a serine protease that plays a crucial role in the immune response, particularly in the cytotoxic activity of natural killer (NK) cells and cytotoxic T lymphocytes (CTLs). It is released by these effector cells to induce apoptosis in target cells, mainly virus-infected or tumor cells. Given its significant role in immune regulation and potential implications in cancer therapy, researchers have focused on the recombinant production of GZMB to better understand its functional mechanisms and explore its therapeutic potential. The expression of GZMB in recombinant systems allows for the generation of large quantities of the protein, which can be used for in vitro assays, structural studies, and the development of GZMB-based therapeutic strategies. The ability to produce GZMB recombinantly also facilitates investigations into its substrate specificity, the design of GZMB inhibitors, and the exploration of its role in various diseases. Moreover, GZMB is of interest for developing novel immunotherapeutic approaches, such as enhancing its expression in immune cells or using it as a target for drug design, to improve anticancer immunity or modulate autoimmune conditions. Research into GZMB recombinant proteins continues to expand our understanding of immune mechanisms and provides a platform for innovative therapeutic applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US