Analytical Data
-
Gene name
GZMB
- Application
-
Alternative Names
GZMB;DFNA5;ICERE1;Gasdermin-E
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10144
-
Expression Region
19-247aa
-
AA Sequence
GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGS SINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKA KRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQ EDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVS YGRNNGMPPRACTKVSSFVHWIKKTMKRY
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Granzyme B (GZMB) is a serine protease that plays a crucial role in the immune response, particularly in the cytotoxic activity of natural killer (NK) cells and cytotoxic T lymphocytes (CTLs). It is released by these effector cells to induce apoptosis in target cells, mainly virus-infected or tumor cells. Given its significant role in immune regulation and potential implications in cancer therapy, researchers have focused on the recombinant production of GZMB to better understand its functional mechanisms and explore its therapeutic potential. The expression of GZMB in recombinant systems allows for the generation of large quantities of the protein, which can be used for in vitro assays, structural studies, and the development of GZMB-based therapeutic strategies. The ability to produce GZMB recombinantly also facilitates investigations into its substrate specificity, the design of GZMB inhibitors, and the exploration of its role in various diseases. Moreover, GZMB is of interest for developing novel immunotherapeutic approaches, such as enhancing its expression in immune cells or using it as a target for drug design, to improve anticancer immunity or modulate autoimmune conditions. Research into GZMB recombinant proteins continues to expand our understanding of immune mechanisms and provides a platform for innovative therapeutic applications.











