Cat: PA1000-4740

Recombinant Human IGF2BP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IGF2BP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IGF2BP2;IMP2;VICKZ2;Insulin-like growth factor 2 mRNA-binding Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y6M1

  • Expression Region

    1-220aa

  • AA Sequence

    MASMTGGQQMGRGSEFMMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQV LLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKI QIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAK IAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPG GTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITLEHHHHHH

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IGF2BP2, or Insulin-like Growth Factor 2 mRNA Binding Protein 2, is a crucial RNA-binding protein that plays a significant role in post-transcriptional regulation of gene expression. Its importance has been underscored by its association with various physiological and pathological processes, including growth, development, and metabolism. Research indicates that IGF2BP2 is involved in the stability and translation of mRNAs related to insulin signaling and glucose metabolism, making it particularly relevant to studies of diabetes and obesity. Furthermore, IGF2BP2 is implicated in cancer biology, with evidence suggesting that its deregulation can contribute to tumorigenesis by enhancing the expression of oncogenes and inhibiting tumor suppressor genes. The study of IGF2BP2 recombinant proteins provides valuable insights into the mechanism of RNA binding and regulatory functions, allowing researchers to elucidate its role in cellular processes and disease states. By leveraging recombinant protein technology, scientists can create specific IGF2BP2 variants to investigate their binding affinities, target mRNAs, and regulatory effects in various cellular contexts. This research not only enhances our understanding of IGF2BP2's biological functions but also opens potential avenues for therapeutic interventions in diseases linked to its dysregulation, such as metabolic disorders and cancer. Therefore, the study of IGF2BP2 recombinant proteins is pivotal for advancing our knowledge in molecular biology and developing strategies for treating related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US