Analytical Data
-
Gene name
H2BC3
- Application
-
Alternative Names
H2BC3;H2BFF;HIST1H2BB;Histone H2B type 1-B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33778
-
Expression Region
2-126aa
-
AA Sequence
PEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
-
Molecular Weight
29.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H2BC3 is a histone variant that plays a crucial role in chromatin structure and gene regulation. Recent studies have highlighted its involvement in various biological processes, including DNA repair, cell proliferation, and differentiation. Unlike conventional histones, H2BC3 exhibits specific expression patterns, particularly during embryonic development and in response to certain stimuli, suggesting a regulatory function in developmental and stress-related pathways. Research has indicated that the overexpression or dysregulation of H2BC3 is associated with several diseases, including cancer, where it may influence tumor progression and metastasis by altering chromatin accessibility and gene expression profiles. Investigating the mechanisms by which H2BC3 modulates chromatin dynamics and its interactions with other epigenetic factors could provide valuable insights into its role in health and disease. Furthermore, understanding H2BC3's function may pave the way for novel therapeutic approaches targeting epigenetic modifications in various pathologies. With the advent of advanced techniques such as CRISPR/Cas9, researchers are now better equipped to manipulate H2BC3 and study its effects in different cellular contexts, enhancing our understanding of its biological significance and potential applications in regenerative medicine and cancer therapy. Overall, the exploration of H2BC3 and its reassembly into the chromatin landscape represents a promising frontier in epigenetic research, as scientists strive to decipher the intricate relationships between histone variants, gene expression, and cellular fate.











