Analytical Data
-
Gene name
TMX2
- Application
-
Alternative Names
TMX2；TXNDC14；Thioredoxin-related transmembrane Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y320
-
Expression Region
125-296aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMTCKPPLYMGPEYIKYFNDKTIDEELERDK RVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVST RYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIRE FNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMX2, or Transmembrane and Tetratricopeptide Repeat Containing 2, is a member of the TMX family that plays a critical role in various cellular processes, including protein folding and oxidative stress responses. The significance of TMX2 has gained attention due to its involvement in cellular homeostasis and its potential link to several diseases, including cancer and neurodegenerative disorders. Recent studies have suggested that TMX2 may modulate the endoplasmic reticulum (ER) stress response and contribute to maintaining protein quality control, which is crucial for cell survival. The exploration of TMX2 as a recombinant protein has opened avenues for understanding its functional mechanisms and interactions within the cell. By producing TMX2 in vitro, researchers can investigate its structural properties, assess its role in mitigating ER stress, and screen for potential therapeutic targets. Furthermore, elucidating the pathways regulated by TMX2 can provide insights into its function in disease contexts, thereby paving the way for the development of novel strategies to manipulate its activity for therapeutic benefits. Overall, the study of TMX2 recombinant protein is a promising area of research that aims to uncover its biological significance and therapeutic potential in human health and disease.
