Analytical Data
-
Gene name
TMIGD2
- Application
-
Alternative Names
TMIGD2；CD28H；IGPR1；Transmembrane and immunoglobulin domain-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96BF3
-
Expression Region
23-150aa
-
AA Sequence
LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYIT NGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELE EAEGNITRLFVDPDDPTQNRNRIASFPG
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMIGD2, or Transmembrane and Immunoglobulin Domain Containing 2, is a protein that has garnered increasing interest in the field of immunology and cancer research. Discovered as a novel immunoglobulin-like receptor, TMIGD2 is primarily expressed in immune cells and plays a vital role in regulating immune responses. Its significance stems from its potential involvement in modulating T cell activation and survival, as well as its correlation with various diseases, including autoimmune disorders and cancers. The study of recombinant TMIGD2 protein is crucial for understanding its functional mechanisms and interactions with other proteins, as well as its potential as a therapeutic target. Researchers aim to characterize the structural and functional properties of TMIGD2 through recombinant expression systems, enabling them to explore its signaling pathways and biological implications. Furthermore, elucidating the role of TMIGD2 in tumor microenvironments may provide insights into immune evasion strategies employed by cancer cells, thereby contributing to the development of novel immunotherapies. With ongoing research on TMIGD2 and its implications in immune regulation, the recombinant protein serves as a pivotal tool for unraveling the complex networks of cellular communication within the immune system and offers promising avenues for therapeutic intervention in immune-related diseases.
