Cat: PA1000-4707

Recombinant Human TGOLN2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TGOLN2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TGOLN2;TGN46;TGN51;Trans-Golgi network integral membrane Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43493

  • Expression Region

    22-381aa

  • AA Sequence

    ATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKSS AEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTKD STSKSHPELQTPKDSTGKSGAEAQTPEDSPNRSGAEAKTQKDSPSKSGSE AQTTKDVPNKSGADGQTPKDGSSKSGAEDQTPKDVPNKSGAEKQTPKDGS NKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSD NKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDV EPKEAEDDDTGPEEGSPPKEEKEKMSGSASSENREGTLSDSTGSEKDDLY PNGSGNGSAEVDHHHHHH

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TGOLN2, or Trans-Golgi Network Protein 2, is an essential protein involved in various cellular processes, particularly in the transport and sorting of proteins within the Golgi apparatus. Research on TGOLN2 has gained traction due to its pivotal role in maintaining cellular homeostasis and its implications in various diseases, including cancer and neurodegenerative disorders. Understanding the structure and function of TGOLN2 is crucial for elucidating its mechanism in vesicle trafficking, which is vital for proper cell function. Moreover, abnormalities in TGOLN2 expression or function can lead to disruptions in the Golgi network, contributing to pathological conditions. Recent studies have focused on the recombinant expression of TGOLN2 to facilitate detailed biochemical and structural analysis. This research not only enhances our comprehension of TGOLN2's role in cellular logistics but also paves the way for potential therapeutic interventions targeting Golgi-associated pathways. Overall, TGOLN2 represents a compelling target for further investigation aimed at deciphering its contributions to cell biology and disease pathology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US