Analytical Data
-
Gene name
TDGF1
- Application
-
Alternative Names
TDGF1；CRIPTO-1；TDGF1；Protein Cripto
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13385
-
Expression Region
32-150aa
-
AA Sequence
GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
-
Molecular Weight
17.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TDGF1, or Teratocarcinoma-Derived Growth Factor 1, is a protein originally identified in teratocarcinoma cell lines, where it plays a significant role in regulating cellular growth and differentiation. Found to be expressed in embryonic stem cells, TDGF1 has garnered attention for its potential involvement in developmental processes and stem cell biology. Research has indicated that TDGF1 may influence the maintenance of pluripotency and the early stages of embryogenesis, making it crucial for understanding normal development as well as mechanisms underlying various diseases, including cancer and regenerative disorders. The interest in TDGF1 has expanded in recent years, focusing on its unique signaling pathways and interactions with other growth factors. Studies suggest that TDGF1 might also serve as a biomarker for specific cancers, particularly those related to testicular and germ cell tumors. Furthermore, the recombinant production of TDGF1 has enabled advanced studies into its functional properties, facilitating investigations into its applications in therapeutic contexts, such as enhancing stem cell-derived therapies or modulating tumor growth. Understanding the nuanced roles of TDGF1 in cellular processes could lead to significant insights into both developmental biology and potential clinical applications, underscoring the importance of this research in contemporary biomedical science.
