Cat: PA1000-4704

Recombinant Human CLIC5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CLIC5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CLIC5;Chloride intracellular channel Protein 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NZA1

  • Expression Region

    1-251aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMTDSATANGDDRDPEIELFVKAGIDGESIG NCPFSQRLFM ILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEE FLEETLTPEK YPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDD YLNTPLPEEI DANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE MTGLWRYLKN AYARDEFTNTCAADSE

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CLIC5 (Chloride Intracellular Channel 5) is a member of the CLIC (Chloride Intracellular Channel) protein family, known for its pivotal roles in maintaining cellular chloride ion homeostasis and regulating various physiological processes. Recent research emphasizes the significance of CLIC5 in cardiovascular and renal function, as well as its involvement in cell migration and proliferation. Dysregulation of CLIC5 has been associated with several pathological conditions, including hypertension, kidney diseases, and cancer. Given its critical functions, there is an increasing interest in developing recombinant CLIC5 proteins for functional studies, structural analysis, and potential therapeutic applications. The production of a properly folded and functional recombinant CLIC5 protein is essential for elucidating its mechanisms of action, interactions with other cellular components, and its role in health and disease. Such studies aim to provide insights into its biological significance and pave the way for novel therapeutic strategies targeting CLIC5 in various diseases, underscoring the need to investigate its structure-function relationship comprehensively.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US