Analytical Data
-
Gene name
TRAT1
- Application
-
Alternative Names
TRAT1；TCRIM；T-cell receptor-associated transmembrane adapter 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PIZ9
-
Expression Region
29-186aa
-
AA Sequence
MNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDEN CYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQ NTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGL IRAKREPIN
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TRAT1, or T cell receptor-associated transducer protein 1, is a key regulator in T cell signaling pathways and immune responses. Research on TRAT1 has gained momentum due to its potential role in modulating T cell activation and differentiation, which are crucial in both adaptive immunity and various immunological disorders. TRAT1 is implicated in several essential processes, such as the assembly of the T cell receptor complex and the trafficking of signaling molecules within T cells. Recent studies have shown that its dysregulation may contribute to autoimmune diseases, chronic infections, and cancer progression, making it a target of interest for therapeutic interventions. Understanding the structure and function of TRAT1, especially through the production and characterization of its recombinant protein, could provide insights into its mechanisms of action and offer novel strategies for manipulating immune responses. Additionally, investigating TRAT1's interactions with other proteins and its involvement in signaling pathways may reveal potential biomarkers for disease states and therapeutic targets. As research in this area advances, TRAT1 continues to emerge as a significant player in immunology, highlighting the importance of studying its recombinant forms to pave the way for future applications in immunotherapy and vaccine development.
