Cat: PA2000-1974

Recombinant Human EIF4G1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EIF4G1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EIF4G1;EIF4F;EIF4G;EIF4GI;Eukaryotic translation initiation factor 4 gamma 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q04637

  • Expression Region

    1250-1599aa

  • AA Sequence

    IEEYLHLNDMKEAVQCVQELASPSLLFIFVRHGVESTLERSAIAREHMGQ LLHQLLCAGHLSTAQYYQGLYEILELAEDMEIDIPHVWLYLAELVTPILQ EGGVPMGELFREITKPLRPLGKAASLLLEILGLLCKSMGPKKVGTLWREA GLSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAPGQRALPSEELNRQLEK LLKEGSSNQRVFDWIEANLSEQQIVSNTLVRALMTAVCYSAIIFETPLRV DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDAL YDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EIF4G1 (Eukaryotic Translation Initiation Factor 4 Gamma 1) is a crucial component of the eukaryotic translation initiation machinery, playing a significant role in protein synthesis regulation. It serves as a scaffold for the assembly of various initiation factors and is pivotal for the recruitment of ribosomes to the mRNA. Research has identified EIF4G1 as a central player in cellular processes beyond translation, such as cell growth and differentiation. Dysregulation of EIF4G1 has been implicated in various diseases, including cancer, where it may contribute to the uncontrolled proliferation of cells through enhanced protein synthesis. As a result, EIF4G1 has garnered attention as a potential therapeutic target. Recent studies have focused on characterizing its structure and function, exploring its interactions with other proteins, and investigating its role in different cellular contexts. Understanding the intricacies of EIF4G1's activity could lead to novel strategies for treating diseases associated with translation dysregulation, making it a significant subject of ongoing research in molecular biology and translational medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US