Analytical Data
-
Gene name
EphB6
- Application
-
Alternative Names
EphB6；Ephrin type-B receptor 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15197
-
Expression Region
617-1021aa
-
AA Sequence
VVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTTSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV
-
Molecular Weight
70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EphB6 is a member of the Eph receptor tyrosine kinase family, which plays a critical role in cell signaling processes such as cell positioning, migration, and differentiation during development and tissue homeostasis. Unlike its EphB family counterparts, EphB6 is characterized as a "truncated" receptor, lacking a functional kinase domain that impairs its ability to initiate downstream signaling cascades upon ligand binding. This unique feature positions EphB6 as a potential negative regulator of Eph receptor signaling, suggesting it may play a crucial role in modulating the activity of other Eph receptors in various biological contexts. Research has indicated that EphB6 is involved in several physiological and pathological processes, including tumorigenesis, neural development, and immune responses. Its expression patterns are notably altered in certain cancers, indicating its potential as a biomarker and therapeutic target. Given the complexity of the Eph receptor signaling network and the unique properties of EphB6, recombinant EphB6 protein studies aim to elucidate its functional roles and interactions with ligands and other receptors. This research might provide insights into the mechanisms of Eph receptor signaling modulation, helping to define the therapeutic potential of targeting EphB6 in diseases where its regulatory functions are disrupted. Thus, the investigation of EphB6 recombinant proteins is vital for understanding its biological significance and potential applications in clinical settings, particularly in cancer biology and therapeutic interventions.
