Analytical Data
-
Gene name
EIF3E
- Application
-
Alternative Names
EIF3E;EIF3S6;INT6;Eukaryotic translation initiation factor 3 subunit E
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60228
-
Expression Region
1-445aa
-
AA Sequence
MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
-
Molecular Weight
59.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E) is a critical component of the eukaryotic translation initiation factor 3 (eIF3) complex, which plays a vital role in the regulation of protein synthesis. This protein is involved in the recruitment of mRNA and the ribosome to initiate translation, thus facilitating the proper expression of genes. Studies have shown that EIF3E is not only essential for normal cellular function but also implicated in various diseases, including cancer and neurodegenerative disorders, due to its role in translational control. Overexpression of EIF3E has been observed in several malignancies, suggesting its potential as a biomarker for cancer progression and a target for therapeutic intervention. Research on EIF3E recombinant proteins is aimed at elucidating its structural and functional properties, enabling a better understanding of its mechanisms of action in translation initiation. Furthermore, this research provides insights into its interactions with other proteins and RNA, which is crucial for developing strategies to modulate its activity in disease contexts. By producing and characterizing EIF3E recombinant proteins, scientists aim to establish a foundation for potential drug design and therapeutic approaches, making it a significant focus in molecular biology and cancer research.











