Analytical Data
-
Gene name
CRIP2
- Application
-
Alternative Names
CRIP2；CRP2；Cysteine-rich Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52943
-
Expression Region
1-208aa
-
AA Sequence
MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
-
Molecular Weight
38.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRIP2 (Cysteine-Rich Protein 2) is a member of the CRIP family, characterized by a distinctive cysteine-rich domain that suggests a potential role in various physiological processes. This protein has garnered research interest due to its involvement in cellular signaling pathways, which are crucial for the regulation of cell growth, differentiation, and survival. Studies have indicated that CRIP2 may play a significant role in the development and function of the nervous system, as well as being implicated in various diseases, including cancer and neurodegenerative disorders. The ability of CRIP2 to interact with multiple partners, including other proteins, RNA, and cellular membranes, positions it as a key player in the interplay between different cellular processes. Given the increasing evidence of CRIP2's role in disease mechanisms, the focus has shifted towards developing recombinant forms of this protein to better understand its function at a molecular level. By employing techniques such as recombinant DNA technology, researchers are able to produce CRIP2 in a controlled setting, enabling detailed biochemical assays and structural studies. These insights not only enhance our understanding of CRIP2's biological role but also pave the way for potential therapeutic applications targeting CRIP2-related pathways in various diseases. Thus, the study of CRIP2 recombinant proteins stands as a promising area of inquiry in cell biology and medicine.
