Cat: PA2000-1942

Recombinant Human CRIP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRIP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CRIP2;CRP2;Cysteine-rich Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P52943

  • Expression Region

    1-208aa

  • AA Sequence

    MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP

  • Molecular Weight

    38.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRIP2 (Cysteine-Rich Protein 2) is a member of the CRIP family, characterized by a distinctive cysteine-rich domain that suggests a potential role in various physiological processes. This protein has garnered research interest due to its involvement in cellular signaling pathways, which are crucial for the regulation of cell growth, differentiation, and survival. Studies have indicated that CRIP2 may play a significant role in the development and function of the nervous system, as well as being implicated in various diseases, including cancer and neurodegenerative disorders. The ability of CRIP2 to interact with multiple partners, including other proteins, RNA, and cellular membranes, positions it as a key player in the interplay between different cellular processes. Given the increasing evidence of CRIP2's role in disease mechanisms, the focus has shifted towards developing recombinant forms of this protein to better understand its function at a molecular level. By employing techniques such as recombinant DNA technology, researchers are able to produce CRIP2 in a controlled setting, enabling detailed biochemical assays and structural studies. These insights not only enhance our understanding of CRIP2's biological role but also pave the way for potential therapeutic applications targeting CRIP2-related pathways in various diseases. Thus, the study of CRIP2 recombinant proteins stands as a promising area of inquiry in cell biology and medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US