Analytical Data
-
Gene name
CPD
- Application
-
Alternative Names
CPD；Carboxypeptidase D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75976
-
Expression Region
383-461aa
-
AA Sequence
GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP
-
Molecular Weight
15.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CPD (Cyclic Peptide Drug) recombinant proteins have emerged as a pivotal area of research due to their promising applications in therapeutics and diagnostics. With the increasing prevalence of various diseases, including cancer and infectious diseases, there is a significant need for novel treatment options that exhibit better efficacy and safety profiles than traditional drugs. Recombinant protein technology enables the production of proteins with high specificity and activity, which can be tailored to target specific biological pathways or disease mechanisms. Cyclic peptides, in particular, are known for their enhanced stability, reduced immunogenicity, and improved binding affinity to targets compared to linear peptides. This makes them ideal candidates for therapeutic development. Moreover, advancements in genetic engineering and biotechnology have facilitated the efficient production and purification of these proteins, paving the way for their application in drug discovery and development. Research into CPD recombinant proteins aims to explore their structure-function relationships, optimize their pharmacokinetic properties, and assess their therapeutic efficacy in preclinical and clinical settings. As a result, the ongoing studies in this field are crucial for the development of innovative, effective, and safe treatments that could significantly impact patient care and the management of various diseases.
