Cat: PA1000-4450

Recombinant Human B4GALT4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    B4GALT4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    B4GALT4;UGALT;UGT;UGTL;UDP-galactose translocator

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60513

  • Expression Region

    39-344aa

  • AA Sequence

    QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQS KLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILVPHRNREKHLM YLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWD CFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTAL SREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVF HTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITV DFWFGA

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

B4GALT4, or Beta-1,4-galactosyltransferase 4, is an enzyme that plays a crucial role in the synthesis of glycoproteins and glycolipids by catalyzing the transfer of galactose to terminal N-acetylglucosamine residues. Its importance is underscored in various biological processes, including cell signaling, adhesion, and immune responses. Aberrant expression or mutations in B4GALT4 have been implicated in several metabolic and developmental disorders, highlighting the necessity for understanding its function and regulation. Recent studies have focused on the enzyme's structure and mechanism, aiming to elucidate the specific pathways it influences and its interactions with substrate molecules. Recombinant B4GALT4 proteins have been developed to investigate these aspects further, providing valuable insights into glycosylation patterns critical for cellular function. Additionally, research into B4GALT4 could pave the way for novel therapeutic strategies targeting glycosylation-related diseases, as enhanced knowledge of its enzymatic properties may lead to innovations in drug design and biotechnological applications. Overall, the study of B4GALT4 and its recombinant forms represents a significant advancement in the field of glycoscience, with the potential to address vital questions regarding carbohydrate metabolism and its associated pathological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US