Analytical Data
-
Gene name
Cps1
- Application
-
Alternative Names
Cps1；CYP21；CYP21B；Steroid 21-hydroxylase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31327
-
Expression Region
1400-1500aa
-
AA Sequence
ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDN YVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKA A
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cps1 is a crucial protein involved in the biosynthesis of polysaccharides and has garnered significant attention in biochemical and genetic research due to its role in bacterial virulence and pathogenesis. It is primarily found in certain pathogenic bacteria, where it contributes to the formation of capsules that protect the bacteria from host immune responses. The study of Cps1 recombinant protein is essential, as it provides insights into the mechanisms of bacterial survival and infection. Moreover, understanding its structure and function could have implications for vaccine development and therapeutic strategies against bacterial infections. Recent advances in recombinant DNA technology have enabled the expression and purification of Cps1, allowing for in-depth characterization of its biochemical properties and interaction with other cellular components. This research not only enhances our knowledge of microbial pathogenesis but also opens up potential applications in biomedicine and biotechnology. As researchers continue to explore the functional attributes of Cps1 and its derivatives, the findings could lead to innovative approaches for combating bacterial diseases, making it a focal point in ongoing scientific investigations.
