Analytical Data
-
Gene name
LILRA2
- Application
-
Alternative Names
LILRA2；ILT1；LIR7；Leukocyte immunoglobulin-like receptor subfamily A member 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N149
-
Expression Region
1-483aa
-
AA Sequence
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LILRA2, a member of the leukocyte immunoglobulin-like receptor (LILR) family, plays a crucial role in the immune system by modulating immune responses. The LILR family consists of both activating and inhibitory receptors that interact with MHC class I molecules, influencing the activity of various immune cells, including natural killer (NK) cells and T cells. Research on LILRA2 has gained attention due to its potential implications in autoimmune diseases, cancer immunotherapy, and infectious diseases. The protein is predominantly expressed on immune cells, where it is thought to be involved in regulating inflammation and maintaining immune homeostasis. Investigating LILRA2, particularly through recombinant protein studies, enables a better understanding of its structure-function relationships and how it interacts with ligands. These studies may reveal novel therapeutic targets for enhancing immune responses or counteracting excessive inflammation in various pathological conditions. Furthermore, LILRA2’s role in disease progression and its expression profiles across different types of cancer suggest that it could serve as a biomarker for disease prognosis or treatment response, underscoring the importance of studying this receptor in the context of both basic immunology and clinical applications.
