Analytical Data
-
Gene name
LMAN2L
- Application
-
Alternative Names
LMAN2L；VIPL；VIP36-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H0V9
-
Expression Region
1-348aa
-
AA Sequence
MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEY LKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWN RVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDK FVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGC TAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYY FGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLP EMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LMAN2L, or “Lectin Mannose Binding 2-Like,” is a protein that has garnered significant attention in recent years due to its potential roles in cellular processes and disease mechanisms. Research indicates that LMAN2L is involved in the transport of glycoproteins within the endoplasmic reticulum and Golgi apparatus, impacting protein folding and maturation. Its dysfunction has been linked to various pathological conditions, including immunological disorders and cancer. Recent studies suggest that LMAN2L may also play a role in the immune response by influencing the presentation of antigens. Given the crucial functions of glycoprotein processing in health and disease, understanding the molecular mechanisms underlying LMAN2L's activity is essential. This has led to increased interest in generating recombinant LMAN2L proteins for detailed functional studies, which may illuminate its role in cellular signaling and disease progression. Additionally, recombinant proteins provide a platform for exploring potential therapeutic applications, as manipulating LMAN2L function could open new avenues for treating diseases associated with its dysregulation. In summary, the study of LMAN2L recombinant proteins is pivotal for advancing our understanding of its biological roles and therapeutic potential, making it a focal point of ongoing research efforts in molecular biology and medicine.
