Analytical Data
-
Gene name
CDC25C
- Application
-
Alternative Names
CDC25C；M-phase inducer phosphatase 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30307
-
Expression Region
1-473aa
-
AA Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
-
Molecular Weight
84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDC25C is a critical phosphatase that plays a vital role in the regulation of the cell cycle, specifically in the transition from the G2 phase to mitosis. It activates cyclin-dependent kinase 1 (CDK1) by dephosphorylating inhibitory phosphates, thereby promoting cell division. Dysregulation of CDC25C has been implicated in various cancers, as its overexpression can lead to unchecked cell proliferation. The reconstitution of CDC25C as a recombinant protein is of great interest for both basic research and potential therapeutic applications. By studying CDC25C in vitro, researchers aim to elucidate its structure-function relationship, regulatory mechanisms, and interactions with other cell cycle proteins. Moreover, recombinant CDC25C can be utilized in high-throughput screening of small molecules that target its activity, paving the way for novel anticancer strategies. Understanding the precise mechanism by which CDC25C contributes to cell cycle control could provide insights into tumorigenesis and highlight potential biomarkers for cancer diagnostics and treatment efficacy. Additionally, the availability of CDC25C in a recombinant form allows for the development of specific inhibitors that could be explored as targeted cancer therapies, thus bridging the gap between fundamental research and clinical applicability.
