Cat: PA2000-5978

Recombinant Human C14orf172 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C14orf172

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TRMT61A; C14orf172; TRM61; tRNA; adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A; EC 2.1.1.220; mRNA methyladenosine-N(1)-methyltransferase catalytic subunit TRMT61A

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96FX7

  • Expression Region

    1-289 aa

  • AA Sequence

    MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG

  • Molecular Weight

    57.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C14orf172, also known as FAM176A, is a protein of growing interest in the field of molecular biology and genetic research due to its potential roles in various cellular processes. Originally identified through genomic studies, C14orf172 is located on chromosome 14 and encodes a protein involved in cellular signaling and regulation. Recent studies have suggested that C14orf172 may be implicated in several human diseases, including cancer, due to its influence on cell proliferation and apoptosis. Furthermore, its expression patterns vary across different tissues, indicating a possible specialized function in various physiological contexts. The recombinant protein of C14orf172 has been produced to facilitate functional studies and to understand its mechanisms of action at the molecular level. Researchers aim to elucidate the biochemical properties, structural features, and interaction networks of C14orf172, which could lead to insights into its role in health and disease. The advancement in recombinant DNA technology has made it feasible to obtain significant amounts of C14orf172, enabling various assays, including binding studies, activity assays, and structural analysis. This research could pave the way for new therapeutic strategies targeting C14orf172-related pathways, enhancing our understanding of its biological significance and potential as a biomarker or therapeutic target.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US