Analytical Data
-
Gene name
C14orf172
- Application
-
Alternative Names
TRMT61A; C14orf172; TRM61; tRNA; adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A; EC 2.1.1.220; mRNA methyladenosine-N(1)-methyltransferase catalytic subunit TRMT61A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96FX7
-
Expression Region
1-289 aa
-
AA Sequence
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG
-
Molecular Weight
57.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf172, also known as FAM176A, is a protein of growing interest in the field of molecular biology and genetic research due to its potential roles in various cellular processes. Originally identified through genomic studies, C14orf172 is located on chromosome 14 and encodes a protein involved in cellular signaling and regulation. Recent studies have suggested that C14orf172 may be implicated in several human diseases, including cancer, due to its influence on cell proliferation and apoptosis. Furthermore, its expression patterns vary across different tissues, indicating a possible specialized function in various physiological contexts. The recombinant protein of C14orf172 has been produced to facilitate functional studies and to understand its mechanisms of action at the molecular level. Researchers aim to elucidate the biochemical properties, structural features, and interaction networks of C14orf172, which could lead to insights into its role in health and disease. The advancement in recombinant DNA technology has made it feasible to obtain significant amounts of C14orf172, enabling various assays, including binding studies, activity assays, and structural analysis. This research could pave the way for new therapeutic strategies targeting C14orf172-related pathways, enhancing our understanding of its biological significance and potential as a biomarker or therapeutic target.
