Cat: PA1000-4269

Recombinant Human HYAL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HYAL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HYAL1;LUCA1;Hyaluronidase-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q12794-3

  • Expression Region

    1-253aa

  • AA Sequence

    MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQL GWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLP VLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKES CQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLL NPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERK SMW

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HYAL1 (hyaluronidase 1) is an enzyme that plays a crucial role in the degradation of hyaluronic acid, a key component of the extracellular matrix involved in tissue hydration, cell proliferation, and migration. Its significance in various biological processes makes it a potential target for therapeutic applications in diseases such as cancer, where altered hyaluronic acid metabolism can influence tumor progression and metastasis. Research has shown that HYAL1 is overexpressed in certain tumors, correlating with poor prognosis, highlighting its potential as a biomarker. Additionally, understanding the structure and function of recombinant HYAL1 proteins can aid in elucidating their precise biological roles and mechanisms of action. The production of recombinant HYAL1 enables the study of its enzymatic activity, regulation, and interaction with other cellular components in a controlled environment, thus providing insights into its therapeutic potential. Moreover, characterizing HYAL1 may lead to the development of novel drugs aimed at modulating its activity, indicating its importance in both basic research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US