Analytical Data
-
Gene name
PRAF1
- Application
-
Alternative Names
RABAC1; PRA1; PRAF1; Prenylated Rab acceptor protein 1; PRA1 family protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UI14
-
Expression Region
1-419 aa
-
AA Sequence
MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRRVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT
-
Molecular Weight
73.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRAF1, or phospho-regulated adaptor for the FAK family of proteins 1, is a novel adaptor protein that plays a critical role in various cellular processes, including cell adhesion, migration, and proliferation. Initially identified in studies focusing on the regulation of focal adhesion dynamics, PRAF1 has garnered attention due to its involvement in signaling pathways that intersect with cancer biology and inflammatory responses. Various studies indicate that PRAF1 interacts with several key proteins, such as focal adhesion kinase (FAK) and cortactin, contributing to the assembly of signaling complexes that modulate cytoskeletal rearrangements and affect cell behavior. The overexpression or altered expression patterns of PRAF1 have been implicated in several malignancies, suggesting its potential as a biomarker or therapeutic target in cancer treatment. Additionally, research has revealed that PRAF1 is subject to phosphorylation, which can influence its function and interactions, highlighting the importance of post-translational modifications in regulating its activity. Given the diverse roles of PRAF1 in health and disease, ongoing research aims to elucidate its mechanisms of action, define its functional roles in different cellular contexts, and explore its potential applications in disease modeling and therapeutic interventions. Understanding the structure-function relationship of PRAF1 through recombinant protein studies is essential for developing strategies to manipulate its activity for therapeutic benefit, making PRAF1 a focal point of interest in molecular biology and translational research.
