Analytical Data
-
Gene name
C3a
- Application
-
Alternative Names
PIK3C2A；Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16581
-
Expression Region
1-310aa
-
AA Sequence
MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESEL
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C3a is a crucial protein derived from the complement system, which plays a significant role in the innate immune response. Its peptide is generated from the cleavage of complement component C3 and acts as a potent anaphylatoxin, modulating immune cell activation, inflammation, and the recruitment of immune cells to sites of tissue damage or infection. The study of C3a and its recombinant protein serves essential purposes in understanding various immune processes and potential therapeutic applications. Research has shown that C3a can influence the function of various immune cells, including mast cells and macrophages, thus impacting conditions such as allergic reactions, autoimmune diseases, and sepsis. By producing recombinant C3a protein, researchers aim to explore its functional characteristics, therapeutic efficacy, and safety in clinical settings. Moreover, the recombinant protein can serve as a tool for elucidating the molecular mechanisms underlying its biological activities. Overall, the ongoing investigation into C3a recombinant protein is pivotal for advancing our knowledge in immunology and developing novel strategies for treating immune-related disorders.
