Analytical Data
-
Gene name
add
- Application
-
Alternative Names
add；Adducin-related Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22333
-
Expression Region
1-333aa
-
AA Sequence
MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFLTKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVIDGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLFLSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQIGIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGLSREQIRQAQINGLEMAFLSAEEKRALREKVAAK
-
Molecular Weight
52.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of adeno-associated virus (AAV) recently gained attention due to its potential in gene therapy applications and the exploration of its recombinant proteins. AAV is a non-enveloped virus that was discovered as a contaminant of adenovirus preparations and has since been recognized for its ability to deliver therapeutic genes efficiently and safely into human cells. Research into recombinant AAV proteins has focused on understanding their role in viral assembly, infection mechanisms, and host immune response. The modification of these proteins can enhance viral vector capabilities, improve transgene expression, and reduce immunogenicity. Moreover, the use of recombinant AAV proteins opens avenues for developing targeted therapies for genetic disorders, cancers, and other diseases. As scientists continue to unravel the intricacies of AAV biology and its interactions with host cells, the design of advanced AAV-based delivery systems could revolutionize the field of gene therapy, offering new hope for treating previously untreatable conditions. This growing body of research emphasizes the importance of further understanding AAV's biology and optimizing recombinant proteins for therapeutic use, paving the way for innovative medical strategies.
