Analytical Data
-
Gene name
PQLC3
- Application
-
Alternative Names
SLC66A3; C2orf22; PQLC3; Solute carrier family 66 member 3; PQ-loop repeat-containing protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N755
-
Expression Region
1-202 aa
-
AA Sequence
MEAALLGLCNWSTLGVCAALKLPQISAVLAARSARGLSLPSLLLELAGFLVFLRYQCYYGYPPLTYLEYPILIAQDVILLLCIFHFNGNVKQATPYIAVLVSSWFILALQKWIIDLAMNLCTFISAASKFAQLQCLWKTRDSGTVSALTWSLSSYTCATRIITTLMTTNDFTILLRFVIMLALNIWVTVTVLRYRKTAIKAE
-
Molecular Weight
49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PQLC3, a member of the poorly characterized PQLC family of proteins, has emerged as an intriguing subject of research due to its potential role in cellular ion transport and signaling pathways. Initial studies suggest that PQLC3 may be involved in the regulation of intracellular calcium levels, impacting various physiological processes including cell proliferation, apoptosis, and differentiation. As a member of the polycystin-Like family, PQLC3 shows structural similarities to proteins implicated in disease mechanisms such as polycystic kidney disease, prompting interest in its functional characterization. Given its expression in multiple tissues and potential link to health and disease, understanding the biophysical properties and biochemical interactions of PQLC3 through recombinant protein studies could elucidate its biological roles. Additionally, PQLC3 may have implications in neurobiology, cardiology, and metabolic conditions, making it a valuable candidate for therapeutic exploration. As research progresses, the development of recombinant PQLC3 proteins will be crucial in investigating its functional mechanisms and interactions within cellular contexts.
