Cat: PA1000-4266

Recombinant Human TMPO Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMPO

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMPO;CKLFSF6;CKLF-like MARVEL transmembrane domain-containing Protein 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P42167

  • Expression Region

    2-187aa

  • AA Sequence

    PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP PLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDK PRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLRE QGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE

  • Molecular Weight

    20 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMPO (Thymopoietin) is a member of the spectrin family of proteins that plays a crucial role in maintaining the structure and stability of the nuclear envelope and cytoskeleton. It is involved in various cellular processes, including cell proliferation, differentiation, and apoptosis. The study of TMPO-gene recombination and its protein products has garnered attention due to their potential implications in diseases such as cancer and cardiac disorders. Notably, TMPO has been associated with the regulation of gene expression and the response to cellular stress. Research has indicated that abnormal expression levels of TMPO can disrupt cellular functions, leading to various pathological conditions. This has prompted investigations into the structure-function relationship of TMPO and its interactions with other cellular components. Understanding the mechanisms underlying TMPO protein recombination may provide insights into its role in cellular function, disease progression, and potential therapeutic targets. As a result, ongoing studies are focused on elucidating the biochemical properties of TMPO, including its post-translational modifications, subcellular localization, and interaction with other proteins, aiming to uncover its significance in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US