Analytical Data
-
Gene name
TMPO
- Application
-
Alternative Names
TMPO;CKLFSF6;CKLF-like MARVEL transmembrane domain-containing Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42167
-
Expression Region
2-187aa
-
AA Sequence
PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP PLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDK PRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLRE QGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMPO (Thymopoietin) is a member of the spectrin family of proteins that plays a crucial role in maintaining the structure and stability of the nuclear envelope and cytoskeleton. It is involved in various cellular processes, including cell proliferation, differentiation, and apoptosis. The study of TMPO-gene recombination and its protein products has garnered attention due to their potential implications in diseases such as cancer and cardiac disorders. Notably, TMPO has been associated with the regulation of gene expression and the response to cellular stress. Research has indicated that abnormal expression levels of TMPO can disrupt cellular functions, leading to various pathological conditions. This has prompted investigations into the structure-function relationship of TMPO and its interactions with other cellular components. Understanding the mechanisms underlying TMPO protein recombination may provide insights into its role in cellular function, disease progression, and potential therapeutic targets. As a result, ongoing studies are focused on elucidating the biochemical properties of TMPO, including its post-translational modifications, subcellular localization, and interaction with other proteins, aiming to uncover its significance in health and disease.











