Analytical Data
-
Gene name
PPARBP
- Application
-
Alternative Names
Activator-recruited cofactor 205 kDa component; ARC205; CRSP1; CRSP200; DRIP205; DRIP230; MED1; MED1_HUMAN; Mediator complex subunit 1; Mediator of RNA polymerase II transcription subunit 1; p53 regulatory protein RB18A; PBP; Peroxisome proliferator-activated receptor-binding protein; PPAR binding protein ; PPAR-binding protein; PPARBP ; PPARGBP; RB18A; Thyroid hormone receptor-associated protein complex 220 kDa component; Thyroid receptor-interacting protein 2; TR-interacting protein 2; Trap220; TRIP-2; TRIP2; Vitamin D receptor-interacting protein complex component DRIP205
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15648
-
Expression Region
878-1031 aa
-
AA Sequence
FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF
-
Molecular Weight
32.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPARBP (Peroxisome Proliferator-Activated Receptor Binding Protein), also known as DRIP205 or TRAP220, is a crucial coactivator involved in the regulation of gene expression mediated by nuclear receptors, particularly peroxisome proliferator-activated receptors (PPARs). PPARs play pivotal roles in lipid metabolism, glucose homeostasis, and inflammatory responses, making PPARBP significant in various physiological and pathological processes, including metabolic disorders, cardiovascular diseases, and cancer. The study of PPARBP includes its interactions with transcription factors, its influence on chromatin remodeling, and its role in the recruitment of other co-regulatory proteins. Furthermore, its dysregulation has been implicated in obesity, insulin resistance, and tumorigenesis, highlighting the need for a deeper understanding of PPARBP's functional mechanisms. Recent advances in recombinant protein technology have enabled the production of PPARBP, facilitating detailed structural and functional characterization studies. This research may provide insights into the therapeutic potential of targeting PPARBP in metabolic and cancer-related diseases, thereby contributing to the development of novel treatment strategies.
