Analytical Data
-
Gene name
PPAPDC3
- Application
-
Alternative Names
PLPP7; C9orf67; PPAPDC3; Inactive phospholipid phosphatase 7; Phosphatidic acid phosphatase type 2 domain-containing protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NBV4
-
Expression Region
1-271 aa
-
AA Sequence
MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERRQSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITGHGIPWIGGTILCLVKSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYEMSPSLLDYLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWALCVGLSRVMIGRHHVTDVLSGFVIGYLQFRLVELVWMPSSTCQMLISAW
-
Molecular Weight
55.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPAPDC3, or Phosphatidic Acid Phosphatase Domain Containing 3, is a vital member of the lipid metabolism family, playing a crucial role in the regulation of phospholipid signaling pathways. Recent studies have highlighted its potential involvement in various physiological processes, including cell proliferation, differentiation, and apoptosis. The dysregulation of PPAPDC3 has been associated with several diseases, particularly metabolic disorders and certain types of cancers, which emphasizes the need to explore its functional mechanisms further. Researchers are particularly interested in understanding how PPAPDC3 interacts with other cellular components and its implications in lipid signaling cascades. The recombinant expression of PPAPDC3 allows for detailed biochemical characterization and functional assays, providing insights into its enzymatic activity and substrate specificity. Furthermore, studying PPAPDC3 at a molecular level can reveal its potential as a therapeutic target, opening new avenues for drug development aimed at modulating lipid metabolism and addressing related diseases. Ultimately, the investigation into PPAPDC3's structure-function relationships and regulatory mechanisms may lead to significant advancements in our understanding of lipid biology and its clinical applications.
