Analytical Data
-
Gene name
TMEM65
- Application
-
Alternative Names
TMEM65；Transmembrane Protein 65
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PI78
-
Expression Region
63-240aa
-
AA Sequence
MEALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPTPG QLRYVFIHNAIPFIGFGFLDNAIMIVAGTHIEMSIGIILGISTMAAAALG NLVSDLAGLGLAGYVEALASRLGLSIPDLTPKQVDMWQTRLSTHLGKAVG VTIGCILGMFPLIFFGGGEEDEKLETKS
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM65, a member of the transmembrane protein family, has gained research interest due to its potential role in cellular processes and human diseases. Initially identified in various tissues, TMEM65 is believed to be involved in cellular metabolism and mitochondrial functions. Recent studies have indicated that mutations or dysregulation of TMEM65 may lead to a range of neurological disorders, including mitochondrial myopathy and other hereditary conditions. As a membrane-associated protein, TMEM65's structure and function are crucial for understanding its biological roles. The development of recombinant TMEM65 protein offers significant opportunities for elucidating its molecular interactions and pathways. By producing this protein in a controlled laboratory environment, researchers can investigate its biochemical properties, assess its interactions with other cellular components, and explore its potential as a therapeutic target. The study of TMEM65 not only enhances our understanding of basic biological processes but also paves the way for novel approaches in treating genetic disorders linked to mitochondrial dysfunction. Consequently, the recombination and characterization of TMEM65 protein will provide valuable insights into its function and its implications in human health and disease.
