Analytical Data
-
Gene name
CD86
- Application
-
Alternative Names
CD86；CD28LG2；T-lymphocyte activation antigen CD86
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42081
-
Expression Region
26-247aa
-
AA Sequence
APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKE KFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRI HQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLL RTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETD KTRLLSSPFSIELEDPQPPPDHIP
-
Molecular Weight
51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD86, also known as B7-2, is a co-stimulatory molecule expressed on antigen-presenting cells (APCs) that plays a critical role in immune regulation and activation. The interaction between CD86 and its receptors, CD28 and CTLA-4 on T cells, is pivotal for effective T cell activation and proliferation. Understanding CD86's role in immune responses is crucial for developing therapeutic strategies for a variety of conditions, including autoimmune diseases, cancers, and infectious diseases. In recent years, recombinant CD86 proteins have garnered attention for their potential applications in immunotherapy and vaccine development. By engineering CD86 as a recombinant protein, researchers can explore its interactions, optimize its biological activity, and assess its therapeutic efficacy in vivo. Studies have shown that modulating CD86 expression can enhance the immune response against tumors, making it a target for cancer immunotherapy. Additionally, recombinant CD86 can be used to create novel vaccines that promote robust T cell responses. The ongoing research in this area aims to elucidate the precise mechanisms of CD86-mediated co-stimulation and to harness its properties for designing improved immunotherapeutic approaches. Overall, the study of recombinant CD86 proteins holds promise in advancing our understanding of immune regulation and fostering innovative treatments for various diseases.
