Analytical Data
-
Gene name
LSAMP
- Application
-
Alternative Names
LSAMP；IGLON3；Limbic system-associated membrane Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13449
-
Expression Region
29-315aa
-
AA Sequence
VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKW SLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIV QVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGE EEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNE ATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVT NVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINVDHHHHHH
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of LSAMP (Lateral Sufficiently Demonstrated Protein) recombinant proteins stems from the increasing interest in understanding the molecular mechanisms underlying cell-cell interactions and neural development. LSAMP is a glycosylphosphatidylinositol-anchored protein expressed in various tissues, notably in the nervous system where it plays a critical role in neural cell adhesion and signal transduction. Its involvement in neuronal differentiation and potential links to psychiatric disorders demand a deeper exploration of its structural and functional properties. The production of recombinant LSAMP enables researchers to dissect its biological function, characterize its interactions with other cell adhesion molecules, and investigate its signaling pathways. Furthermore, understanding LSAMP's role in neurodevelopment may provide insights into its implications in diseases such as schizophrenia and autism spectrum disorders. Utilizing techniques such as protein engineering and advanced imaging allows scientists to study LSAMP in vitro and in vivo, paving the way for potential therapeutic targets. Overall, LSAMP recombinant protein research represents a significant frontier in neurobiology, aiming to unravel complex cellular processes that govern brain function and development.
