Analytical Data
-
Gene name
PPAPDC1B
- Application
-
Alternative Names
PLPP5; DPPL1; HTPAP; PPAPDC1B; Phospholipid phosphatase 5; Phosphatidic acid phosphatase type 2 domain-containing protein 1B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NEB5
-
Expression Region
1-175 aa
-
AA Sequence
MWLYRNPYVEAEYFPTKPMFVIAFLSPLSLIFLAKFLKKADTRDSRQACLAASLALALNGVFTNTIKLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDVVNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWRFCAFLSPLLFAAVIALSRTCDYKHHWQGPFKW
-
Molecular Weight
46.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPAPDC1B, or phosphatidic acid phosphatase type 2B, is a member of the lipid phosphatase family, playing a crucial role in regulating cellular signaling and lipid metabolism. Recent studies have highlighted its involvement in various physiological processes, including inflammation, cell proliferation, and apoptosis. Dysregulation of PPAPDC1B has been implicated in several diseases, including cancer and metabolic disorders, making it a potential therapeutic target. The recombinant protein of PPAPDC1B is of particular interest for researchers aiming to understand its functional properties and mechanisms of action. By producing and characterizing this recombinant protein, scientists can investigate its enzymatic activity and interactions with other cellular components, providing insights into its role in lipid metabolism and signaling pathways. This research not only enhances our understanding of PPAPDC1B’s biological functions but also paves the way for developing novel therapeutic strategies targeting related pathologies. Furthermore, studying recombinant PPAPDC1B can facilitate the exploration of its potential as a biomarker for certain diseases, as well as its application in drug development aimed at modulating lipid signaling pathways. Overall, the investigation of PPAPDC1B recombinant protein is vital for elucidating the complex biochemical networks that govern cellular behavior and their implications in health and disease.
