Cat: PA2000-1821

Recombinant Human MLLT3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MLLT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MLLT3;AF9;YEATS3;Protein AF-9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P42568

  • Expression Region

    1-138aa

  • AA Sequence

    MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA

  • Molecular Weight

    23.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MLLT3 (Myeloid/Lymphoid or Mixed-Lineage Leukemia 3) is a gene involved in chromosomal translocations associated with various hematological malignancies, particularly acute leukemias. The MLLT3 protein, originally identified as a fusion partner in MLL (Mixed-Lineage Leukemia) gene rearrangements, plays a critical role in the regulation of gene expression and hematopoietic differentiation. Its dysregulation is implicated in the pathogenesis of leukemia through mechanisms like altered transcriptional control and disruption of normal cellular signaling pathways. The study of MLLT3 recombinant protein is essential for understanding its functional properties and interactions with other molecular components in the cell. By producing and characterizing recombinant MLLT3, researchers aim to dissect its role in oncogenesis and its potential as a therapeutic target. Investigating the protein’s structure, binding partners, and cellular functions may provide insights into the development of novel treatments for leukemia and improve our ability to diagnose and stratify patients based on specific genetic alterations. Overall, MLLT3 serves as a significant focus in cancer biology, highlighting the intricate connections between chromosomal abnormalities and disease progression.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US