Analytical Data
-
Gene name
C10orf84
- Application
-
Alternative Names
Protein FAM204A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H8W3
-
Expression Region
1-147aa
-
AA Sequence
MFLNGNCLETLKKKEPEGGRRRLSHPGNMGWMRPSQETTPPDRSHHSGFGLFCGDPGPEIEPFSLWVFPQEMVLEIHQLFMDHEYPCHHITSHCTWVAAHWTTSQSCAAWQGCRRACCSTWWKSPAQCTRPTVMSATFETAQEPGPS
-
Molecular Weight
43.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C10orf84, a gene located on chromosome 10, has garnered attention due to its potential roles in various biological processes and disease mechanisms. Although its function remains largely elusive, increasing evidence suggests that C10orf84 may be involved in cellular signaling pathways and immune responses. Recent studies have reported associations between C10orf84 expression levels and conditions such as cancer, autoimmune diseases, and neurodegenerative disorders, indicating its potential as a biomarker or therapeutic target. Recombinant protein studies of C10orf84 aim to elucidate its biochemical properties and interactions at the molecular level, providing insights into its functional role in health and disease. By producing and characterizing the C10orf84 protein in vitro, researchers seek to better understand its structure-function relationships, post-translational modifications, and the impact of its variants. Such investigations are critical for developing novel strategies for diagnosis and treatment, particularly in diseases where C10orf84 is implicated. Overall, the exploration of C10orf84 recombinant protein serves as a foundation for unraveling the complexities of this gene and its relevance in biomedical research.
