Cat: PA2000-5888

Recombinant Human C10orf82 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C10orf82

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C10orf82; CJ082_HUMAN; FLJ40268; MGC33547; Uncharacterized Protein C10orf82

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WW14

  • Expression Region

    1-154aa

  • AA Sequence

    MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEE

  • Molecular Weight

    44.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C10orf82, also known as the "chromosome 10 open reading frame 82," has emerged as a protein of interest in recent biomedical research due to its potential role in various cellular processes and its association with several diseases. It is located on chromosome 10 and is characterized by a predicted protein structure that suggests it may participate in cellular signaling, gene regulation, and possibly immune responses. Studies have shown that C10orf82 is expressed in various tissues, indicating its potential relevance in both normal physiological and pathological conditions. Notably, aberrant expression of C10orf82 has been correlated with cancer progression, neurodegenerative diseases, and autoimmune disorders. As researchers seek to elucidate its function, recombinant C10orf82 protein is being produced to facilitate biochemical studies, which are crucial for understanding its molecular mechanisms and interactions with other proteins. This recombinant form serves as a valuable tool for investigating the protein's structure-function relationship, post-translational modifications, and the pathways it influences. Additionally, studying the impact of C10orf82 on cellular behavior can unveil its therapeutic potential and lead to the development of targeted interventions for diseases associated with its dysregulation. As such, C10orf82 represents a promising subject for ongoing research with implications for improving our understanding of complex biological systems and advancing treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US