Analytical Data
-
Gene name
C10orf82
- Application
-
Alternative Names
C10orf82; CJ082_HUMAN; FLJ40268; MGC33547; Uncharacterized Protein C10orf82
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WW14
-
Expression Region
1-154aa
-
AA Sequence
MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEE
-
Molecular Weight
44.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C10orf82, also known as the "chromosome 10 open reading frame 82," has emerged as a protein of interest in recent biomedical research due to its potential role in various cellular processes and its association with several diseases. It is located on chromosome 10 and is characterized by a predicted protein structure that suggests it may participate in cellular signaling, gene regulation, and possibly immune responses. Studies have shown that C10orf82 is expressed in various tissues, indicating its potential relevance in both normal physiological and pathological conditions. Notably, aberrant expression of C10orf82 has been correlated with cancer progression, neurodegenerative diseases, and autoimmune disorders. As researchers seek to elucidate its function, recombinant C10orf82 protein is being produced to facilitate biochemical studies, which are crucial for understanding its molecular mechanisms and interactions with other proteins. This recombinant form serves as a valuable tool for investigating the protein's structure-function relationship, post-translational modifications, and the pathways it influences. Additionally, studying the impact of C10orf82 on cellular behavior can unveil its therapeutic potential and lead to the development of targeted interventions for diseases associated with its dysregulation. As such, C10orf82 represents a promising subject for ongoing research with implications for improving our understanding of complex biological systems and advancing treatment strategies.











