Analytical Data
-
Gene name
TNFRSF12A
- Application
-
Alternative Names
TNFRSF12A;FN14;Tumor necrosis factor receptor superfamily member 12A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NP84
-
Expression Region
28-79aa
-
AA Sequence
EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRL LW
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF12A, also known as the Tumor Necrosis Factor Receptor Superfamily Member 12A or Fn14, is a receptor that plays a significant role in various biological processes, including inflammation, cell survival, and immune regulation. Research has increasingly focused on TNFRSF12A due to its involvement in several diseases, particularly in cancer and autoimmune disorders. Its ligand, TWEAK (TNF-like weak inducer of apoptosis), binds to TNFRSF12A to activate signaling pathways that can lead to either pro-inflammatory responses or apoptosis, depending on the cellular context. Moreover, studies have shown that TNFRSF12A may influence tumor growth and metastasis, making it a potential target for therapeutic interventions. The development of recombinant TNFRSF12A proteins is essential for further elucidating its biological functions and therapeutic potential. By producing and characterizing these recombinant proteins, researchers can study their interactions, signaling mechanisms, and effects on various cell types. This could ultimately lead to novel approaches in treating diseases where TNFRSF12A is implicated. As a result, understanding TNFRSF12A through recombinant protein technology may pave the way for innovative therapies aimed at modulating its activity in pathological conditions, enhancing the promise of precision medicine in oncology and immunology.











